PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn362911
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 1526aa    MW: 172427 Da    PI: 5.0925
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn362911genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.2e-192479257
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                 kR+  t++qle+Le+ ++++ yp +++r+eL++klgL++rq ++WF+ rR kekk
  Achn362911 24 PKRQMKTPYQLEILEKTYAMETYPLEATRAELSEKLGLSDRQLQMWFCHRRLKEKK 79
                69*****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-19579IPR009057Homeodomain-like
SuperFamilySSF466896.42E-161579IPR009057Homeodomain-like
PROSITE profilePS5007116.3582080IPR001356Homeobox domain
SMARTSM003891.0E-172284IPR001356Homeobox domain
PfamPF000461.5E-162479IPR001356Homeobox domain
CDDcd000866.75E-142579No hitNo description
PROSITE profilePS5082714.941457516IPR018501DDT domain
SMARTSM005715.5E-20457516IPR018501DDT domain
PfamPF027914.6E-16458513IPR018501DDT domain
PfamPF050669.4E-13639706IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156123.9E-10822865IPR028942WHIM1 domain
PfamPF156139.2E-1410231094IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1526 aa     Download sequence    Send to blast
MEAVSEGENN KNSDESPIEE PKKPKRQMKT PYQLEILEKT YAMETYPLEA TRAELSEKLG  60
LSDRQLQMWF CHRRLKEKKD LGAKKTKHAG GVEKKGLFDP ARDELMAAER GSNHGSRSGS  120
GSESGSGWSR FDERDDVPMA ATRSHREYLL DEPKIRSDVY ERLIPSNFYD QPVECPSASA  180
PLLLHHNGQL SRGYGIQGQA SCPSLSSQQS KQGLFSSPSG DNNCIPQWES LINMPIDAQD  240
NSQPAGMPDN IDASDRHISN SESGLQIEKK RKSNEARIGS QVDAHEKRIR KELEQQDILR  300
RKREEQMRRE MEKQDRERRK DEERMVREKQ RQQERFEREE RRENERREKF LQKESLKAER  360
RRQKEELRRE KEEARLKAAI ERATTRRIAR ESMELIEDER LELMELAASS KGLPSIISLD  420
YDTLQNLESF RGFLYSFPPK SVQLKRPFSV QPWTDSEENI GNLLMVWRSC ITFADVLGLW  480
PFTLDEFVQA FHDYDSRLLG EIHISLLKLI IKDIEDGART LSNGIGTNQC SSANPEGGHP  540
QIVEGAYVWG FDIRNWKNHL NPLTWPEILR QFALSAAFGP QLKKKSIKRA GFPDNDETKG  600
CQDIISTLRN GAAAENAVAI MQEKGFPLQR RSRHRLTPGT VKFAAYHVLS LEGSKGMNVI  660
ELAHKIQKSG LRDLTTSKTP EASISVALSR DAVLFERTAP STYRVRPPFR KDPADADAIL  720
SAAREKIKRY ENGFLAGEIV DDVERDEHSE AEGAEGPEIY GIGTPNANRN NNNGNEVGIC  780
SGNGKERFLD DVTQNLQNEP DAADNGSNNL NQGDPEIDEG DSGEPWVQGL AEGEYSDLSV  840
EERLKALVTL VGICNEGNSI RSVLEGSNGM LVNFLSFHAE SFLQDRLDAA NALKKQMLAE  900
AQLDKKRIKE ESFPKCNTSF MGIEAETKQT CAAADSSQSP LTAVDNKIRE SPLETKVNEE  960
PSVEAENLQH DNPLPADRMP VEPEASMGQI GSSIQQNGYT AERSRMQLKS YIGHRAEEMY  1020
IYRSLPLGQD RRRNRYWQFV ASASSNDPGS GRIFVESPDG CWRLIDSEKA FDALLESLDT  1080
RGIRESHLHI MLQNIEKSFK ETIRRNSQCA IITDRSGNIG REDAEMDCSP AHSGGDDSPS  1140
STVSGSNTNT CEPSFSFGIE LGKSETEKKA SMERYQEFQK WMWKECFNSS TLCAMKYGEK  1200
RCRPLLEICD FCLDSYKVVN DLCPSCYRSF GDFDDQITLS ELCEDKRKAS PRNSNISKFS  1260
HPSRIRLLRA ILTTIEKYLF ANILFQFFQK LQSRYTFMMN IEDTEQGKHR KEKNSTDLAS  1320
MREIYGHRQK GICGRGRGRG RPQKRFVGSG RQNLSMSSGQ VLRQQGQRTH GQRLTRGRRT  1380
VRRRRIEESA VPETLLGHLG NTGGLKISDI LPRNSSGEEE EEENCGGEEI RQMQIEDADK  1440
RNGLEAVESD ADDQIVEYEY EKWGTGNAMV MSDEDVDGSE DENGFEEIGE ENFEVDVDMN  1500
EDSDGNGDGN ENGSTDQSDS EDFSD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17279RRLKEKKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096357.10.0PREDICTED: uncharacterized protein LOC105175572 isoform X1
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A068TTV70.0A0A068TTV7_COFCA; Uncharacterized protein
STRINGSolyc02g077660.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21422352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.10.0homeobox-1